| Desktop | 0/100 | ✘ |
| Mobile | 40/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 96 KB | ✔ |
| Compression | 14 KB (-85.4%) | ✔ |
| Text/Html Ratio | 2215 / 105972 (bytes) = 2.09% | ❗ |
| Load Time | 0.54 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 8 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-AU | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | No | ✘ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 2 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| digital | 25 | ✔ | ✔ | ✔ |
| marketing | 20 | ✔ | ✔ | ✔ |
| sign | 6 | ✘ | ✘ | ✘ |
| solutionscustomisable | 6 | ✘ | ✘ | ✘ |
| account | 6 | ✘ | ✘ | ✘ |
| bookings | 6 | ✘ | ✘ | ✘ |
| services | 6 | ✔ | ✘ | ✔ |
| servicessydney | 4 | ✘ | ✘ | ✘ |
| contact | 3 | ✘ | ✘ | ✘ |
| solutionsbuild | 2 | ✘ | ✘ | ✘ |
| digitalmarketing | 2 | ✘ | ✘ | ✘ |
| includes | 2 | ✘ | ✘ | ✘ |
| marketingsolutionscustomisable | 2 | ✘ | ✘ | ✘ |
| internet | 2 | ✘ | ✘ | ✘ |
| brand's | 2 | ✘ | ✘ | ✘ |
|
With 0.54 seconds in page load, 96 KB of page size and all other reports below, the sydneydigitalmarketingservices.com has a SEO score of 57 out of 100 |
| Title | Digital Marketing - SYDNEY DIGITAL MARKETING SERVICES |
| Description | Customisable and affordable digital marketing plans that suit your business needs. |
| Keyword |
| Age | 0 Years, 3 Days |
| Created | 29th-Jun-2020 |
| Updated | 29th-Jun-2020 |
| Expiry | 29th-Jun-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain Name: sydneydigitalmarketingservices.com Registry Domain ID: 2542478275_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-06-29T09:39:38Z Creation Date: 2020-06-29T09:39:37Z Registrar Registration Expiration Date: 2021-06-29T09:39:37Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 14455 N. Hayden Road Registrant City: Scottsdale Registrant State/Province: Arizona Registrant Postal Code: 85260 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: sydneydigitalmarketingservices.com@domainsbyproxy.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 14455 N. Hayden Road Admin City: Scottsdale Admin State/Province: Arizona Admin Postal Code: 85260 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: sydneydigitalmarketingservices.com@domainsbyproxy.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 14455 N. Hayden Road Tech City: Scottsdale Tech State/Province: Arizona Tech Postal Code: 85260 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: sydneydigitalmarketingservices.com@domainsbyproxy.com Name Server: NS47.DOMAINCONTROL.COM Name Server: NS48.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-07-02T07:00:00Z |
| Server IP | 160.153.136.3 |
| Server Location | United States |
| Service Provider | Host Europe GmbH |
| Domains (TLD) | Status |
|---|---|
| sydneydigitalmarketingservices.net | Available |
| sydneydigitalmarketingservices.org | Available |
| sydneydigitalmarketingservices.biz | Already Registered |
| sydneydigitalmarketingservices.io | Already Registered |
| sydneydigitalmarketingservices.info | Available |
| Domains (TLD) | Status |
|---|---|
| qydneydigitalmarketingservices.com | Available |
| wydneydigitalmarketingservices.com | Available |
| eydneydigitalmarketingservices.com | Available |
| zydneydigitalmarketingservices.com | Available |
| xydneydigitalmarketingservices.com | Available |
| Terradebasket.com |
| 35rnbot.com |
| 1528wrosemont1w.info |
| Bazaar-art.com |
| Tomyamkoong.com |
| Warnerjapan.com |
| Taelli.com |
| Pinbocai.com |
| Ajnieto.com |
| Caiav.com |